HEAVENLY SCENT företagsadress: 3012SWCountyRoad18,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6029532545 (+1-602-953-2545) Faxnummer: 6029531117 (+1-602-953-1117) hemsida: cuontop. com, royallyscrewed. com e-post: USA SIC -koden: 9999 USA SIC Catalog: Unclassified
|
HARRYVARDAKIS-PALMDESERTREALTY företagsadress: 30syStrt,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6029935773 (+1-602-993-5773) Faxnummer: 6029935773 (+1-602-993-5773) hemsida: azdbacks. com, azdbackstickets. com e-post: USA SIC -koden: 653118 USA SIC Catalog: Real Estate
|
HARRY VARDAKIS - PALM DESERT REALTY företagsadress: 30 Easy Street,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 4804883099 (+1-480-488-3099) Faxnummer: 4804885483 (+1-480-488-5483) hemsida: palmdesertrealty. com e-post: USA SIC -koden: 6531 USA SIC Catalog: Real Estate
|
GRAHAM ENGINEERING & SURVEYING företagsadress: PO Box 1243,CAREFREE,AZ,USA postnummer: 85377-1243 Telefonnummer : 4804882488 (+1-480-488-2488) Faxnummer: 4804884393 (+1-480-488-4393) hemsida: e-post: USA SIC -koden: 871111 USA SIC Catalog: Engineers-Consulting
|
GENERATION ONE BUSINESS RUGS AND FURNITURE LIQUIDA företagsadress: 15721 N GreenwayHayden Loop,CAREFREE,AZ,USA postnummer: 85255 Telefonnummer : 2032235056 (+1-203-223-5056) Faxnummer: hemsida: gobliquidators. com e-post: USA SIC -koden: 571216 USA SIC Catalog: Furniture
|
GAILWILSONREALESTATE företagsadress: 11SundilCirclPOox5163,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6239795400 (+1-623-979-5400) Faxnummer: 6239797733 (+1-623-979-7733) hemsida: az-realty. net, frankboyd. com, greatest-gifts. com, greatest-gifts. net, homesells. net, i-net-realty. co e-post: USA SIC -koden: 653118 USA SIC Catalog: Real Estate
|
GAIL WILSON REAL ESTATE företagsadress: 11 Sundial Circle PO Box 5163,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 4804882074 (+1-480-488-2074) Faxnummer: hemsida: e-post: USA SIC -koden: 6531 USA SIC Catalog: Real Estate
|
G. ALLEN SANDERS & ASSOC företagsadress: 8025 W Dahlia Dr,CAREFREE,AZ,USA postnummer: 85380 Telefonnummer : Faxnummer: hemsida: gallensanders. com e-post: USA SIC -koden: 861102 USA SIC Catalog: Associations
|
FOOTHILLS DEMOCRATS företagsadress: P. O. Box 5913,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6022346590 (+1-602-234-6590) Faxnummer: hemsida: foothillsdemocrats. com e-post: USA SIC -koden: 865101 USA SIC Catalog: Political Organizations
|
FOOTHILLS COMMUNITY FOUNDATION företagsadress: P. O. Box 2800-333,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 4804881090 (+1-480-488-1090) Faxnummer: 4804882310 (+1-480-488-2310) hemsida: az-fcf. org e-post: USA SIC -koden: 832229 USA SIC Catalog: Community Services
|
FLAGSTONE MASTERS företagsadress: PO Box 2534,CAREFREE,AZ,USA postnummer: 85377-2534 Telefonnummer : 4804883393 (+1-480-488-3393) Faxnummer: 4804880300 (+1-480-488-0300) hemsida: e-post: USA SIC -koden: 141101 USA SIC Catalog: Stone-Natural
|
FITNESS TOGETHER företagsadress: PO Box 5384,CAREFREE,AZ,USA postnummer: 85377-5384 Telefonnummer : Faxnummer: 4804888100 (+1-480-488-8100) hemsida: e-post: USA SIC -koden: 799106 USA SIC Catalog: Personal Trainers-Fitness
|
FIRE RELATED EQUIPMENT företagsadress: P.O. Box 2182,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6238783733 (+1-623-878-3733) Faxnummer: hemsida: fredfire. com;fredlogo. com e-post: USA SIC -koden: 353401 USA SIC Catalog: Mfg Elevators/escalators Building Equipment Installatio
|
ETERNAL PRESENCE; företagsadress: P.O. Box 143,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 4809637627 (+1-480-963-7627) Faxnummer: hemsida: eternalpets. com e-post: USA SIC -koden: 573407 USA SIC Catalog: Computer & Equipment Dealers
|
ERIC JUNGERSEN företagsadress: PO Box 1104,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6233261750 (+1-623-326-1750) Faxnummer: hemsida: mediarate. com e-post: USA SIC -koden: 7319 USA SIC Catalog: Media services
|
EQUITY SAVERS REALTY företagsadress: PO Box 2540,CAREFREE,AZ,USA postnummer: 85377-2540 Telefonnummer : Faxnummer: 4804887708 (+1-480-488-7708) hemsida: e-post: USA SIC -koden: 653118 USA SIC Catalog: Real Estate
|
EQUITY SAVERS företagsadress: P.O. Box 2540,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 4804887708 (+1-480-488-7708) Faxnummer: hemsida: e-post: USA SIC -koden: 6531 USA SIC Catalog: Real Estate
|
ELIZABETH GAYNOR företagsadress: POox5785,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : Faxnummer: hemsida: e-post: USA SIC -koden: 653108 USA SIC Catalog: Real Estate Management
|
DUTCH QUALITY STONE företagsadress: PO Box 2616,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6156738938 (+1-615-673-8938) Faxnummer: hemsida: monarchstone. com e-post: USA SIC -koden: 738999 USA SIC Catalog: Business Services Nec
|
DR. JOHN A. AMARO D.C företagsadress: P.O. Box 2929,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 5206343349 (+1-520-634-3349) Faxnummer: 5206343131 (+1-520-634-3131) hemsida: e-post: USA SIC -koden: 594716 USA SIC Catalog: Party Supplies
|
DOPPLER SYSTEMS företagsadress: 7530 E Nonchalant Ave,CAREFREE,AZ,USA postnummer: 85377 0000 Telefonnummer : 4804881295 (+1-480-488-1295) Faxnummer: 4804889755 (+1-480-488-9755) hemsida: www. dopsys. com e-post: USA SIC -koden: 506519 USA SIC Catalog: Electronic Equipment & Supplies-Whol
|
DOMAIN ADMINISTRATION DA-OR företagsadress: 127 Strawberry Hill Rd,CAREFREE,AZ,USA postnummer: 85366 Telefonnummer : 6235447121 (+1-623-544-7121) Faxnummer: 6235447121 (+1-623-544-7121) hemsida: myazstrippers. com, pornportalxxx. com, xxxpornportal. com e-post: USA SIC -koden: 7379 USA SIC Catalog: Computer Related Services NEC
|
DIGITAL DREAMSCAPE LLC företagsadress: ,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6028751125 (+1-602-875-1125) Faxnummer: 6029972694 (+1-602-997-2694) hemsida: arizonamarket. com, digitaldreamscape. com, eternalnight. com, giftlineexpress. com, johndiehl. com, john e-post: USA SIC -koden: 594515 USA SIC Catalog: Baskets
|
DIALUP DESIGNS DIV. OF MASTER DESIGN STUDIO; INC. företagsadress: PO BOX 2800-310,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6023750588 (+1-602-375-0588) Faxnummer: hemsida: serioussigns. com e-post: USA SIC -koden: 738991 USA SIC Catalog: Plants
|
DIALUP DESIGNS DIV. OF MASTER DESIGN STUDIO; INC. företagsadress: P.O. BOX 2800-310,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : Faxnummer: hemsida: theresorts. com e-post: USA SIC -koden: 8999 USA SIC Catalog: Services NEC
|
DIALUP DESIGNS DIV OF MASTER DESIGN STUDIO; INC företagsadress: PO BOX 2800310,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 8888888888 (+1-888-888-8888) Faxnummer: hemsida: starprofits. com e-post: USA SIC -koden: 7389 USA SIC Catalog: Business Services NEC
|
DESERTFORESTREALTY företagsadress: POox8157SundilCircl,CAREFREE,AZ,USA postnummer: 85377 Telefonnummer : 6233349216 (+1-623-334-9216) Faxnummer: hemsida: shop1gift. com e-post: USA SIC -koden: 653118 USA SIC Catalog: Real Estate
|
Show 136-162 record,Total 224 record First Pre [1 2 3 4 5 6 7 8 9] Next Last Goto,Total 9 Page |